PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_3577_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 383aa    MW: 41921.1 Da    PI: 8.3471
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_3577_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.63.1e-4291167278
                    -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    C v+gC+adls++++yhrrhkvCe hsk+p+v++ g++qrfCqqCsrfh+l+efDe+krsCr+rL++hn+rrrk+q+
  Neem_3577_f_2  91 CLVDGCDADLSNCRDYHRRHKVCELHSKTPQVTIGGQKQRFCQQCSRFHSLEEFDEGKRSCRKRLDGHNRRRRKPQP 167
                    **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.0E-3483152IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.15488165IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-3989170IPR004333Transcription factor, SBP-box
PfamPF031101.5E-3191164IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MDWNSKTPWD FSDFEHEAIP NVDAVDGSSN FGGTRAKGNF SVDLKLGQVN NSVDNSLNKW  60
KEAGVSKMES STSGSSKRAR AAGNGSHNVS CLVDGCDADL SNCRDYHRRH KVCELHSKTP  120
QVTIGGQKQR FCQQCSRFHS LEEFDEGKRS CRKRLDGHNR RRRKPQPDPL SRSGGFLSNY  180
QGTQLLPFSS SHMYPSANVV NNPWAGVVNS EADARHYTQH QHLNLHDKQN LFLGSSPSSY  240
NGGKPFTFLQ GDSSNLKSPT SPKASVSQPL LRTAALSERS GGSYNMFRER SATRDSDCAL  300
SLLSSPSTQS HTSGISLSHI VQPSSLPLVS LGTSLHNHSI EPRESVLASS GRDANVHCPG  360
MFQLGSDEST ANDAPQTIPF QWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-28911641184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147164KRSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006493224.10.0PREDICTED: squamosa promoter-binding-like protein 13A
RefseqXP_006436866.10.0hypothetical protein CICLE_v10031834mg
TrEMBLB8Y9B20.0B8Y9B2_PONTR; Squamosa promoter-binding protein
STRINGPOPTR_0015s11100.11e-161(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41112759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-76SBP family protein